PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010098893.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family Trihelix
Protein Properties Length: 493aa    MW: 56884.1 Da    PI: 5.6897
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010098893.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix97.98.5e-3142126187
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                     rW++qe+laL+e+r++m++++r+++ k+plWe++s+km e g++rs+k+Ckek+en+ k++k++++g+++r+  + +++++f+qlea
  XP_010098893.1  42 RWPRQETLALLEIRSDMDSKFRDSSVKAPLWEDISRKMGELGYNRSAKKCKEKFENIYKYHKRTRDGRSGRA--NGKNYRFFEQLEA 126
                     8********************************************************************985..4557*******85 PP

2trihelix101.66e-32324409187
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                     rW+k+ev aLi++r++++ +++++  k+plWe++s++mr+ g+ rs+k+Ckekwen+nk++k++k+++kkr  e+s+tcpyf ql+a
  XP_010098893.1 324 RWPKDEVDALIRLRTNLDVQYQDNGPKGPLWEDISAAMRKIGYDRSSKRCKEKWENINKYFKRVKDSNKKR-VEDSKTCPYFYQLDA 409
                     8*********************************************************************8.78889*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007179.1E-439101IPR001005SANT/Myb domain
CDDcd122032.85E-2541106No hitNo description
PfamPF138371.1E-1941127No hitNo description
PROSITE profilePS500907.1084199IPR017877Myb-like domain
PROSITE profilePS500907.666317381IPR017877Myb-like domain
SMARTSM007170.0033321383IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-4321380IPR009057Homeodomain-like
PfamPF138379.8E-22323410No hitNo description
CDDcd122036.56E-24323388No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 493 aa     Download sequence    Send to blast
MLENPTFPEN LPENGGGSVP VGVEEEERVR GEEGDRSWLG NRWPRQETLA LLEIRSDMDS  60
KFRDSSVKAP LWEDISRKMG ELGYNRSAKK CKEKFENIYK YHKRTRDGRS GRANGKNYRF  120
FEQLEALDHH SFDPPSMEET RPTTIPPNNV VLNAIPCSVH KPVEANFDEN SSSSTSSSGE  180
ESEGARKKKR KLTRFFERLM KEVMERQESL QRKFIETLEK CEQDRIAREE AWKAQELERL  240
KRESELLVHE RAIAAAKDAA VLAFLKKFSE QSDQVQFPEN PIASFQKDGD KQEKSQGGNL  300
EQVSLESQEK GSNHRNFSQM SSSRWPKDEV DALIRLRTNL DVQYQDNGPK GPLWEDISAA  360
MRKIGYDRSS KRCKEKWENI NKYFKRVKDS NKKRVEDSKT CPYFYQLDAL YNKKTKKAND  420
SVNSGYDLRP EELLMHMMGS QEEQQQRQLE SVTDQDGEES NDKVDGDGYQ TNTADNNPSQ  480
MTVDNPPSME TMG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1186191KKKRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010098893.10.0Trihelix transcription factor GT-2
SwissprotQ391172e-78TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLW9RGP40.0W9RGP4_9R
STRINGVIT_04s0044g00510.t011e-179(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37334181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.23e-65Trihelix family protein